A synthetic peptide corresponding to a sequence in the middle region of human RUNX1 (200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.
Conjugation:
Unconjugated
Alternative Names:
Runt-related transcription factor 1,Acute myeloid leukemia 1 protein,Core-binding factor subunit alpha-2,CBF-alpha-2,Oncogene AML-1,Polyomavirus enhancer-binding protein 2 alpha B subunit,PEA2-alpha B,PEBP2-alpha B,SL3-3 enhancer factor 1 alpha B subunit
RUNX1/AML1 Antibody
Clonality:
Polyclonal
Concentration:
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
WB: The detection limit for RUNX1 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the
* VAT and and shipping costs not included. Errors and price changes excepted
