RUNX2 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: RUNX2 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB215912
• Supplier Catalog Number: orb215912
• Alternative Catalog Number: BYT-ORB215912-10,BYT-ORB215912-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2 (244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
• Conjugation: Unconjugated
• Alternative Names: Runt-related transcription factor 2,Acute myeloid leukemia 3 protein,Core-binding factor subunit alpha-1,CBF-alpha-1,Oncogene AML-3,Osteoblast-specific transcription factor 2,OSF-2,Polyomavirus enhancer-binding protein 2 alpha A subunit,PEA2-alpha A,PEBP

Product Description

RUNX2 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 56 kDa
• Sensitivity: < 5pg/ml
• UniProt: Q13950
• Form: Lyophilized

Application Notes

• Application Notes: WB: The detection limit for RUNX2 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0