ACE2 (Human) Recombinant Protein (Q01)
Catalog Number:
BYT-ORB2285064
| Article Name: |
ACE2 (Human) Recombinant Protein (Q01) |
| Biozol Catalog Number: |
BYT-ORB2285064 |
| Supplier Catalog Number: |
orb2285064 |
| Alternative Catalog Number: |
BYT-ORB2285064-10 |
| Manufacturer: |
Biorbyt |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Human ACE2 partial ORF (NP_068576.1, 18 a.a. - 116 a.a.) recombinant protein with GST tag at N-terminal. |
| Clonality: |
Recombinant |
| NCBI: |
068576 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRL |
| Application Notes: |
Best use within three months from the date of receipt of this protein. |
