TMPRSS2 (Human) Recombinant Protein (P01)

Catalog Number: BYT-ORB2286413
Article Name: TMPRSS2 (Human) Recombinant Protein (P01)
Biozol Catalog Number: BYT-ORB2286413
Supplier Catalog Number: orb2286413
Alternative Catalog Number: BYT-ORB2286413-10
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Human TMPRSS2 full-length ORF ( AAH51839.1, 1 a.a. - 492 a.a.) recombinant protein with GST-tag at N-terminal.
Clonality: Recombinant
NCBI: 51839
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQS
Application Notes: Best use within three months from the date of receipt of this protein.
orb2286413