Human THRB protein

Catalog Number: BYT-ORB246452
Article Name: Human THRB protein
Biozol Catalog Number: BYT-ORB246452
Supplier Catalog Number: orb246452
Alternative Catalog Number: BYT-ORB246452-20, BYT-ORB246452-100, BYT-ORB246452-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: THRB ERBA2 NR1A2 THR1
Recombinant human Thyroid hormone receptor beta
Molecular Weight: 68.8 kDa
UniProt: P10828
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAP
Application Notes: Full length of His-SUMO-tag and expression region is 1-461aa