Human TMEM141 protein

Product Overview

• Article Name: Human TMEM141 protein
• Biozol Catalog Number: BYT-ORB246457
• Supplier Catalog Number: orb246457
• Alternative Catalog Number: BYT-ORB246457-20, BYT-ORB246457-100, BYT-ORB246457-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: TMEM141

Product Description

Recombinant human Transmembrane protein 141

Product Properties

• Molecular Weight: 38.9 kDa
• UniProt: Q96I45
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

Application Notes

• Application Notes: Full length of GST-tag and expression region is 1-108aa