Human TPD52 protein

Catalog Number: BYT-ORB246460
Article Name: Human TPD52 protein
Biozol Catalog Number: BYT-ORB246460
Supplier Catalog Number: orb246460
Alternative Catalog Number: BYT-ORB246460-20, BYT-ORB246460-100, BYT-ORB246460-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: TPD52
Recombinant human Tumor protein D52
Molecular Weight: 35.9 kDa
UniProt: P55327
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Application Notes: Full length of Isoform 2 of His-SUMO-tag and expression region is 1-184aa