Anti-SARS-CoV-2 NSP8 Antibody (APC), Rabbit, Polyclonal
Catalog Number:
BYT-ORB2602776
| Article Name: |
Anti-SARS-CoV-2 NSP8 Antibody (APC), Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2602776 |
| Supplier Catalog Number: |
orb2602776 |
| Alternative Catalog Number: |
BYT-ORB2602776-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Human |
| Immunogen: |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
| Conjugation: |
APC |
| Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp8, Non-structural protein 8 |
| Anti-SARS-CoV-2 NSP8 Antibody (APC) |
| Clonality: |
Polyclonal |
| Concentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molecular Weight: |
140 kDa, 130 kDa, 110 kDa |
| Sensitivity: |
> 5000 cells |
| UniProt: |
P0DTC1 |
| Buffer: |
Lyophilized |
| Form: |
Lyophilized |
| Application Notes: |
ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |
