Anti-SARS-CoV-2 NSP3 Antibody (APC), Rabbit, Polyclonal
Catalog Number:
BYT-ORB2602797
Article Name: |
Anti-SARS-CoV-2 NSP3 Antibody (APC), Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2602797 |
Supplier Catalog Number: |
orb2602797 |
Alternative Catalog Number: |
BYT-ORB2602797-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ELISA |
Species Reactivity: |
Human |
Immunogen: |
HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK |
Conjugation: |
APC |
Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp3, Non-structural protein 3, PL2-PRO, Papain-like proteinase, PL-PRO |
Anti-SARS-CoV-2 NSP3 Antibody (APC) |
Clonality: |
Polyclonal |
Concentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Molecular Weight: |
140 kDa, 130 kDa, 110 kDa |
Sensitivity: |
> 5000 cells |
UniProt: |
P0DTC1 |
Buffer: |
Lyophilized |
Form: |
Lyophilized |
Application Notes: |
ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |