Anti-SARS-CoV-2 NSP3 Antibody (APC), Rabbit, Polyclonal

Catalog Number: BYT-ORB2602797
Article Name: Anti-SARS-CoV-2 NSP3 Antibody (APC), Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2602797
Supplier Catalog Number: orb2602797
Alternative Catalog Number: BYT-ORB2602797-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Conjugation: APC
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp3, Non-structural protein 3, PL2-PRO, Papain-like proteinase, PL-PRO
Anti-SARS-CoV-2 NSP3 Antibody (APC)
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: 140 kDa, 130 kDa, 110 kDa
Sensitivity: > 5000 cells
UniProt: P0DTC1
Buffer: Lyophilized
Form: Lyophilized
Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml