TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325283
Article Name: |
TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated |
Biozol Catalog Number: |
BYT-ORB325283 |
Supplier Catalog Number: |
orb325283 |
Alternative Catalog Number: |
BYT-ORB325283-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPS2 |
Conjugation: |
Unconjugated |
Alternative Names: |
anti TMPRSS2 antibody, anti PRSS10 antibody, anti antibody |
Rabbit polyclonal antibody to TMPS2 |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
54kDa |
NCBI: |
005647 |
UniProt: |
O15393 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM |
Target: |
TMPRSS2 |
|
Sample Type: Fetal Liver lysates, Antibody Dilution: 1 ug/mL. |