TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325283
Article Name: TMPRSS2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325283
Supplier Catalog Number: orb325283
Alternative Catalog Number: BYT-ORB325283-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPS2
Conjugation: Unconjugated
Alternative Names: anti TMPRSS2 antibody, anti PRSS10 antibody, anti antibody
Rabbit polyclonal antibody to TMPS2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 54kDa
NCBI: 005647
UniProt: O15393
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM
Target: TMPRSS2
Sample Type: Fetal Liver lysates, Antibody Dilution: 1 ug/mL.