Human TMPRSS2 protein

Catalog Number: BYT-ORB358525
Article Name: Human TMPRSS2 protein
Biozol Catalog Number: BYT-ORB358525
Supplier Catalog Number: orb358525
Alternative Catalog Number: BYT-ORB358525-20,BYT-ORB358525-100,BYT-ORB358525-500,BYT-ORB358525-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: D16Ertd61e protein, Epitheliasin protein, FLJ41954 protein, MGC6821 protein, PP9284 protein, PRSS10 protein, Serine protease 10 protein, TMPRSS2 protein, TMPRSS2 ERG FUSION GENE, INCLUDED protein, TMPRSS2 ETV1 FUSION GENE, INCLUDED protein, TMPS2_HUMAN p
Recombinant human Transmembrane protease serine 2 (TMPRSS2), partial
Molecular Weight: 44.8 kDa
UniProt: O15393
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Application Notes: Protein Length: Extracellular Domain