Human MEMO1 protein

Catalog Number: BYT-ORB54546
Article Name: Human MEMO1 protein
Biozol Catalog Number: BYT-ORB54546
Supplier Catalog Number: orb54546
Alternative Catalog Number: BYT-ORB54546-20,BYT-ORB54546-100,BYT-ORB54546-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7
Recombinant human MEMO1 protein
Molecular Weight: 60.7 kDa
UniProt: Q9Y316
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLN
Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-297AAFull Length : Full Length