SLA antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB577934
Article Name: SLA antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB577934
Supplier Catalog Number: orb577934
Alternative Catalog Number: BYT-ORB577934-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLA/LP
Conjugation: Unconjugated
Alternative Names: LP, SLA, PCH2D, SLA/LP
Rabbit polyclonal antibody to SLA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 56 kDa
NCBI: 722547
UniProt: A1A4F3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
Target: SEPSECS