CPEB2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB577945
Article Name: CPEB2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB577945
Supplier Catalog Number: orb577945
Alternative Catalog Number: BYT-ORB577945-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPEB2
Conjugation: Unconjugated
Alternative Names: CPEB-2, CPE-BP2, hCPEB-2
Rabbit polyclonal antibody to CPEB2
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 37kDa
NCBI: 949637
UniProt: Q7Z5Q1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
Target: CPEB2