TMED4 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB577946
| Article Name: |
TMED4 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB577946 |
| Supplier Catalog Number: |
orb577946 |
| Alternative Catalog Number: |
BYT-ORB577946-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMED4 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HNLF, ERS25, p24a3, GMP25iso, p24alpha3 |
| Rabbit polyclonal antibody to TMED4 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
25kDa |
| NCBI: |
872353 |
| UniProt: |
Q7Z7H5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT |
| Target: |
TMED4 |
