TMED4 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB577947
Article Name: TMED4 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB577947
Supplier Catalog Number: orb577947
Alternative Catalog Number: BYT-ORB577947-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED4
Conjugation: Unconjugated
Alternative Names: HNLF, ERS25, p24a3, GMP25iso, p24alpha3
Rabbit polyclonal antibody to TMED4
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 26kDa
NCBI: 872353
UniProt: Q7Z7H5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER
Target: TMED4