WNT2B antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB577974
Article Name: WNT2B antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB577974
Supplier Catalog Number: orb577974
Alternative Catalog Number: BYT-ORB577974-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT2B
Conjugation: Unconjugated
Alternative Names: WNT13
Rabbit polyclonal antibody to WNT2B
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
NCBI: 004176
UniProt: Q93097
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
Target: WNT2B