Doublecortin antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578005
Article Name: Doublecortin antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578005
Supplier Catalog Number: orb578005
Alternative Catalog Number: BYT-ORB578005-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DCX
Conjugation: Unconjugated
Alternative Names: DC, DBCN, LISX, SCLH, XLIS
Rabbit polyclonal antibody to Doublecortin
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 40kDa
NCBI: 835365
UniProt: O43602
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Target: DCX