EFEMP1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578010
Article Name: EFEMP1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578010
Supplier Catalog Number: orb578010
Alternative Catalog Number: BYT-ORB578010-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Conjugation: Unconjugated
Alternative Names: DHRD, DRAD, FBNL, MLVT, MTLV, S1-5, FBLN3, FIBL-3
Rabbit polyclonal antibody to EFEMP1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 53kDa
NCBI: 004096
UniProt: Q12805
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
Target: EFEMP1