MSH2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578016
Article Name: MSH2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578016
Supplier Catalog Number: orb578016
Alternative Catalog Number: BYT-ORB578016-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2
Conjugation: Unconjugated
Alternative Names: FCC1, COCA1, HNPCC, LCFS2, hMSH2, HNPCC1, MMRCS2
Rabbit polyclonal antibody to MSH2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 105kDa
NCBI: 000242
UniProt: P43246
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Target: MSH2