ELAC1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578017
Article Name: ELAC1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578017
Supplier Catalog Number: orb578017
Alternative Catalog Number: BYT-ORB578017-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELAC1
Conjugation: Unconjugated
Alternative Names: D29
Rabbit polyclonal antibody to ELAC1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 40kDa
NCBI: 061166
UniProt: Q9H777
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
Target: ELAC1