ALDOB antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578018
Article Name: ALDOB antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578018
Supplier Catalog Number: orb578018
Alternative Catalog Number: BYT-ORB578018-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOB
Conjugation: Unconjugated
Alternative Names: ALDB, ALDO2
Rabbit polyclonal antibody to ALDOB
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 40kDa
NCBI: 000026
UniProt: P05062
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHE
Target: ALDOB