MYBPC3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578027
Article Name: MYBPC3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578027
Supplier Catalog Number: orb578027
Alternative Catalog Number: BYT-ORB578027-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MYBPC3
Conjugation: Unconjugated
Alternative Names: FHC, CMH4, CMD1MM, LVNC10, MYBP-C, cMyBP-C
Rabbit polyclonal antibody to MYBPC3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 141 kDa
NCBI: 000247
UniProt: Q14896
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVS
Target: MYBPC3