TNNI3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578033
Article Name: TNNI3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578033
Supplier Catalog Number: orb578033
Alternative Catalog Number: BYT-ORB578033-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNNI3
Conjugation: Unconjugated
Alternative Names: CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF
Rabbit polyclonal antibody to TNNI3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 23kDa
NCBI: 000354
UniProt: Q59H18
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
Target: TNNI3