HRG antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578036
Article Name: HRG antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578036
Supplier Catalog Number: orb578036
Alternative Catalog Number: BYT-ORB578036-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HRG
Conjugation: Unconjugated
Alternative Names: HPRG, HRGP, THPH11
Rabbit polyclonal antibody to HRG
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 60kDa
NCBI: 000403
UniProt: P04196
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM
Target: HRG