MAT1A antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578037
Article Name: MAT1A antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578037
Supplier Catalog Number: orb578037
Alternative Catalog Number: BYT-ORB578037-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT1A
Conjugation: Unconjugated
Alternative Names: MAT, SAMS, MATA1, SAMS1
Rabbit polyclonal antibody to MAT1A
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 44 kDa
NCBI: 000420
UniProt: Q00266
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
Target: MAT1A