SERPINC1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578041
Article Name: SERPINC1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578041
Supplier Catalog Number: orb578041
Alternative Catalog Number: BYT-ORB578041-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINC1
Conjugation: Unconjugated
Alternative Names: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2
Rabbit polyclonal antibody to SERPINC1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 52kDa
NCBI: 000479
UniProt: P01008
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
Target: SERPINC1