CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB578043
| Article Name: |
CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB578043 |
| Supplier Catalog Number: |
orb578043 |
| Alternative Catalog Number: |
BYT-ORB578043-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX |
| Rabbit polyclonal antibody to CYP1A1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
58 kDa |
| NCBI: |
000490 |
| UniProt: |
P04798 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
| Target: |
CYP1A1 |
