CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB578043
Article Name: |
CYP1A1 antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB578043 |
Supplier Catalog Number: |
orb578043 |
Alternative Catalog Number: |
BYT-ORB578043-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
Conjugation: |
Unconjugated |
Alternative Names: |
AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX |
Rabbit polyclonal antibody to CYP1A1 |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
58 kDa |
NCBI: |
000490 |
UniProt: |
P04798 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Target: |
CYP1A1 |