REN antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB578046
| Article Name: |
REN antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB578046 |
| Supplier Catalog Number: |
orb578046 |
| Alternative Catalog Number: |
BYT-ORB578046-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human REN |
| Conjugation: |
Unconjugated |
| Alternative Names: |
RTD, HNFJ2, ADTKD4 |
| Rabbit polyclonal antibody to REN |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
45kDa |
| NCBI: |
000528 |
| UniProt: |
P00797 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
| Target: |
REN |
