SFTPB antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578047
Article Name: SFTPB antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578047
Supplier Catalog Number: orb578047
Alternative Catalog Number: BYT-ORB578047-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFTPB
Conjugation: Unconjugated
Alternative Names: SP-B, PSP-B, SFTB3, SFTP3, SMDP1
Rabbit polyclonal antibody to SFTPB
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 42 kDa
NCBI: 000533
UniProt: P07988
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
Target: SFTPB