CA4 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB578051
| Article Name: |
CA4 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB578051 |
| Supplier Catalog Number: |
orb578051 |
| Alternative Catalog Number: |
BYT-ORB578051-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CA4 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CAIV, Car4, RP17 |
| Rabbit polyclonal antibody to CA4 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
35 kDa |
| NCBI: |
000708 |
| UniProt: |
P22748 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG |
| Target: |
CA4 |
