DDC antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB578053
Article Name: |
DDC antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB578053 |
Supplier Catalog Number: |
orb578053 |
Alternative Catalog Number: |
BYT-ORB578053-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDC |
Conjugation: |
Unconjugated |
Alternative Names: |
AADC |
Rabbit polyclonal antibody to DDC |
Clonality: |
Polyclonal |
Concentration: |
1.0 mg/ml |
Molecular Weight: |
53kDa |
NCBI: |
000781 |
UniProt: |
P20711 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Target: |
DDC |