PLA2G5 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578056
Article Name: PLA2G5 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578056
Supplier Catalog Number: orb578056
Alternative Catalog Number: BYT-ORB578056-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5
Conjugation: Unconjugated
Alternative Names: FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Rabbit polyclonal antibody to PLA2G5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 14kDa
NCBI: 000920
UniProt: P39877
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
Target: PLA2G5