MUC1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB578069
Article Name: MUC1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB578069
Supplier Catalog Number: orb578069
Alternative Catalog Number: BYT-ORB578069-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Porcine
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Conjugation: Unconjugated
Alternative Names: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, H23AG, MCKD1, MUC-1, ADMCKD, ADTKD2, ADMCKD1, CA 15-3, MUC-1/X, MUC1/ZD, MUC-1/SEC
Rabbit polyclonal antibody to MUC1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 22kDa
NCBI: 001037855
UniProt: Q7Z552
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Target: MUC1