POFUT2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579594
Article Name: POFUT2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579594
Supplier Catalog Number: orb579594
Alternative Catalog Number: BYT-ORB579594-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POFUT2
Conjugation: Unconjugated
Alternative Names: FUT13, C21orf80
Rabbit polyclonal antibody to POFUT2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 50kDa
NCBI: 598368
UniProt: Q9Y2G5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG
Target: POFUT2