C21orf62 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579598
Article Name: C21orf62 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579598
Supplier Catalog Number: orb579598
Alternative Catalog Number: BYT-ORB579598-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C21orf62
Conjugation: Unconjugated
Alternative Names: B37, PRED81, C21orf120
Rabbit polyclonal antibody to C21orf62
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 28kDa
NCBI: 062542
UniProt: Q9NYP8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL
Target: C21orf62