LRRC3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579601
Article Name: LRRC3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579601
Supplier Catalog Number: orb579601
Alternative Catalog Number: BYT-ORB579601-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC3
Conjugation: Unconjugated
Alternative Names: LRRC3DN, C21orf30, C21orf102
Rabbit polyclonal antibody to LRRC3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 25kDa
NCBI: 112153
UniProt: Q9BY71
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA
Target: LRRC3