C21orf56 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579603
Article Name: C21orf56 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579603
Supplier Catalog Number: orb579603
Alternative Catalog Number: BYT-ORB579603-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf56
Conjugation: Unconjugated
Alternative Names: C21orf56
Rabbit polyclonal antibody to C21orf56
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 21kDa
NCBI: 115637
UniProt: Q9H0A9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLD
Target: SPATC1L