SNF1LK antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579612
Article Name: SNF1LK antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579612
Supplier Catalog Number: orb579612
Alternative Catalog Number: BYT-ORB579612-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNF1LK
Conjugation: Unconjugated
Alternative Names: MSK, SIK, DEE30, SIK-1, SIK1B, SNF1LK
Rabbit polyclonal antibody to SNF1LK
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 85 kDa
NCBI: 775490
UniProt: P57059
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
Target: SIK1