GUCY1B1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579620
Article Name: GUCY1B1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579620
Supplier Catalog Number: orb579620
Alternative Catalog Number: BYT-ORB579620-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GUCY1B3
Conjugation: Unconjugated
Alternative Names: GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1
Rabbit polyclonal antibody to GUCY1B1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70kDa
NCBI: 000848
UniProt: Q02153
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV
Target: GUCY1B1