RRM2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579629
Article Name: RRM2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579629
Supplier Catalog Number: orb579629
Alternative Catalog Number: BYT-ORB579629-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RRM2
Conjugation: Unconjugated
Alternative Names: R2, RR2, RR2M, C2orf48
Rabbit polyclonal antibody to RRM2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 45kDa
NCBI: 001025
UniProt: P31350
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
Target: RRM2