RRM2B antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579630
Article Name: RRM2B antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579630
Supplier Catalog Number: orb579630
Alternative Catalog Number: BYT-ORB579630-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RRM2B
Conjugation: Unconjugated
Alternative Names: P53R2, MTDPS8A, MTDPS8B
Rabbit polyclonal antibody to RRM2B
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
UniProt: Q7LG56
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST
Target: RRM2B