CENPA antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579638
Article Name: CENPA antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579638
Supplier Catalog Number: orb579638
Alternative Catalog Number: BYT-ORB579638-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENPA
Conjugation: Unconjugated
Alternative Names: CenH3, CENP-A
Rabbit polyclonal antibody to CENPA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 16kDa
NCBI: 001800
UniProt: P49450
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Target: CENPA