SMC2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579639
Article Name: SMC2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579639
Supplier Catalog Number: orb579639
Alternative Catalog Number: BYT-ORB579639-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMC2
Conjugation: Unconjugated
Alternative Names: CAPE, CAP-E, SMC-2, SMC2L1
Rabbit polyclonal antibody to SMC2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
NCBI: 03396
UniProt: O95347
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE
Target: SMC2