SKAP1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579642
Article Name: SKAP1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579642
Supplier Catalog Number: orb579642
Alternative Catalog Number: BYT-ORB579642-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SKAP1
Conjugation: Unconjugated
Alternative Names: SCAP1, SKAP55, HEL-S-81p
Rabbit polyclonal antibody to SKAP1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
NCBI: 003717
UniProt: Q86WV1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL
Target: SKAP1