EIF2S3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579645
Article Name: EIF2S3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579645
Supplier Catalog Number: orb579645
Alternative Catalog Number: BYT-ORB579645-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S3
Conjugation: Unconjugated
Alternative Names: EIF2, EIF2G, MEHMO, MRXSBRK, eIF-2gA, EIF2gamma
Rabbit polyclonal antibody to EIF2S3
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 51kDa
NCBI: 001406
UniProt: P41091
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
Target: EIF2S3