CTPS antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579652
Article Name: CTPS antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579652
Supplier Catalog Number: orb579652
Alternative Catalog Number: BYT-ORB579652-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTPS
Conjugation: Unconjugated
Alternative Names: CTPS, GATD5, IMD24
Rabbit polyclonal antibody to CTPS
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 67kDa
NCBI: 001896
UniProt: P17812
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Target: CTPS1