PPAT antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579658
Article Name: PPAT antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579658
Supplier Catalog Number: orb579658
Alternative Catalog Number: BYT-ORB579658-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAT
Conjugation: Unconjugated
Alternative Names: GPAT, PRAT, ATASE
Rabbit polyclonal antibody to PPAT
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 57 kDa
NCBI: 002694
UniProt: Q06203
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
Target: PPAT