CAD antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579671
Article Name: CAD antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579671
Supplier Catalog Number: orb579671
Alternative Catalog Number: BYT-ORB579671-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAD
Conjugation: Unconjugated
Alternative Names: CDG1Z, DEE50, GATD4, EIEE50
Rabbit polyclonal antibody to CAD
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 243kDa
NCBI: 004332
UniProt: P27708
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
Target: CAD