MAGEA3 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579682
Article Name: MAGEA3 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579682
Supplier Catalog Number: orb579682
Alternative Catalog Number: BYT-ORB579682-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAGEA3
Conjugation: Unconjugated
Alternative Names: HIP8, HYPD, CT1.3, MAGE3, MAGEA6
Rabbit polyclonal antibody to MAGEA3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 35kDa
NCBI: 005353
UniProt: P43357
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
Target: MAGEA3